PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016137.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 429aa    MW: 48463.1 Da    PI: 11.7337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016137.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.5e-122569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+ E++++++a  ++G + Wk+I + +  ++t  q++s+ qk+
       Do016137.1 25 RERWTAGEHDRFLRAMVLFGRD-WKRIEALVA-TKTSTQIRSHAQKH 69
                     78******************77.*********.************98 PP

2Myb_DNA-binding391.9e-12205249147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT++E+ ++++a  ++G + Wk+I + +  ++t  q++s+ qk+
       Do016137.1 205 RERWTADEHGRFLQALVLFGRD-WKRIEAFVA-TKTSTQIRSHAQKH 249
                      78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-141975IPR009057Homeodomain-like
PROSITE profilePS5129416.122074IPR017930Myb domain
TIGRFAMsTIGR015571.6E-142472IPR006447Myb domain, plants
SMARTSM007176.0E-82472IPR001005SANT/Myb domain
PfamPF002494.9E-92569IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-62569IPR009057Homeodomain-like
CDDcd001671.25E-52770No hitNo description
SuperFamilySSF466893.96E-15199255IPR009057Homeodomain-like
PROSITE profilePS5129415.938200254IPR017930Myb domain
TIGRFAMsTIGR015576.1E-16204252IPR006447Myb domain, plants
SMARTSM007175.2E-8204252IPR001005SANT/Myb domain
PfamPF002491.5E-9205249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-6205249IPR009057Homeodomain-like
CDDcd001672.28E-6207250No hitNo description
SuperFamilySSF466891.98E-10348405IPR009057Homeodomain-like
SMARTSM007171.3353402IPR001005SANT/Myb domain
CDDcd001670.00504356400No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MAAAARSTGM AGKKPRRPYT ITRPRERWTA GEHDRFLRAM VLFGRDWKRI EALVATKTST  60
QIRSHAQKHF IKAQKLDIVV PPPHPRRAAA VLAQPSVSSP ACSAGGDAMT PSDETLIQLP  120
LSPDDLYFAQ VYRFIGDIFG SDAPRPIETQ LQRLVQAPAI KGGEERNKET NRYTERKRTM  180
MAAAPRSTGM VGKKPRKPYT VTRPRERWTA DEHGRFLQAL VLFGRDWKRI EAFVATKTST  240
QIRSHAQKHF LKAQKLGIAV PPPHPRRAVV LAQPPVSCPA LYAVDAMAPS NDMLAQLPLS  300
PDDLCFAQVY RRRGRARQRH KDRGTKKTMM TVAARSTGMT GKKPRRPYTI TRPRERWTAD  360
EHERFLHARP GDVRLRLEEI EAFVATKTST QIRSHAQKHF LRAQKLGIVA PPPHLRRAGT  420
RHLPRMVCG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981960.12e-80PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU31e-26RVE8_ARATH; Protein REVEILLE 8
TrEMBLC5WQB44e-55C5WQB4_SORBI; Putative uncharacterized protein Sb01g012460
STRINGSb01g012460.11e-54(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.27e-25MYB_related family protein